Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLTP Peptide - N-terminal region

PLTP Peptide - N-terminal region

Product Specifications

Product Name Alternative

BPIFE, HDLCQ9

UniProt

P55058

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLTP Rabbit Polyclonal Antibody (orb589650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001229849.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISE

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cathepsin G ELISA Kit
MBS2882504-01 48 Well

Mouse Cathepsin G ELISA Kit

Sign In for Pricing
View Details
Mouse Cathepsin G ELISA Kit
MBS2882504-02 96 Well

Mouse Cathepsin G ELISA Kit

Sign In for Pricing
View Details
Mouse Cathepsin G ELISA Kit
MBS2882504-03 5x 96 Well

Mouse Cathepsin G ELISA Kit

Sign In for Pricing
View Details
Mouse Cathepsin G ELISA Kit
MBS2882504-04 10x 96 Well

Mouse Cathepsin G ELISA Kit

Sign In for Pricing
View Details
Glut5 (E-2) : m-IgG1 BP-HRP Bundle
sc-543323 1 Kit

Glut5 (E-2) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Recombinant Human AGFG2 Protein
E30P4069 20 µg

Recombinant Human AGFG2 Protein

Sign In for Pricing
View Details