Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S1PR1 Peptide - C-terminal region

S1PR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EDG1, S1P1, CD363, ECGF1, EDG-1, CHEDG1, D1S3362

UniProt

P21453

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with S1PR1 Rabbit Polyclonal Antibody (orb589651) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001391.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trimethoprim EP Impurity F
CS-T-16091 1 Each

Trimethoprim EP Impurity F

Sign In for Pricing
View Details
FGA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV704104 1.0 µg DNA

FGA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
S100A9 (S100 Calcium Binding Protein A9, 60B8AG, Calgranulin B, CAGB, Calprotectin L1H Subunit, CFAG, CGLB, Cystic Fibrosis Antigen, L1AG, Leukocyte L1 Complex Heavy Chain, LIAG, MAC387, Migration Inhibitory Factor-related Protein 14, MIF Related Protein
MBS6393200-01 0.1 mL

S100A9 (S100 Calcium Binding Protein A9, 60B8AG, Calgranulin B, CAGB, Calprotectin L1H Subunit, CFAG, CGLB, Cystic Fibrosis Antigen, L1AG, Leukocyte L1 Complex Heavy Chain, LIAG, MAC387, Migration Inhibitory Factor-related Protein 14, MIF Related Protein

Sign In for Pricing
View Details
S100A9 (S100 Calcium Binding Protein A9, 60B8AG, Calgranulin B, CAGB, Calprotectin L1H Subunit, CFAG, CGLB, Cystic Fibrosis Antigen, L1AG, Leukocyte L1 Complex Heavy Chain, LIAG, MAC387, Migration Inhibitory Factor-related Protein 14, MIF Related Protein
MBS6393200-02 5x 0.1 mL

S100A9 (S100 Calcium Binding Protein A9, 60B8AG, Calgranulin B, CAGB, Calprotectin L1H Subunit, CFAG, CGLB, Cystic Fibrosis Antigen, L1AG, Leukocyte L1 Complex Heavy Chain, LIAG, MAC387, Migration Inhibitory Factor-related Protein 14, MIF Related Protein

Sign In for Pricing
View Details
Human MMP-3/Stromelysin-1 ELISA Kit PicoKine®
EK0461 96 Well With Removable Strips

Human MMP-3/Stromelysin-1 ELISA Kit PicoKine®

Sign In for Pricing
View Details
SIX3 (SIX Homeobox 3, HPE2) (Biotin)
251684-Biotin 100 µL

SIX3 (SIX Homeobox 3, HPE2) (Biotin)

Sign In for Pricing
View Details