Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BUB1B Peptide - N-terminal region

BUB1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

MVA1, SSK1, BUBR1, Bub1A, MAD3L, hBUBR1, BUB1beta

UniProt

O60566

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BUB1B Rabbit Polyclonal Antibody (orb589745) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001202.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQ

More Discoveries

Explore Other Products

Browse additional items from our catalog

DKK1 Recombinant Antibody, PE-Cy5 Conjugated
bsm-61289R-PE-Cy5-01 20 µL

DKK1 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
DKK1 Recombinant Antibody, PE-Cy5 Conjugated
bsm-61289R-PE-Cy5-02 100 µL

DKK1 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
MRX82 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV734227 1.0 µg DNA

MRX82 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Human CIART Protein, N-GST & C-His
HA556012-01 50 µg

Recombinant Human CIART Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human CIART Protein, N-GST & C-His
HA556012-02 100 µg

Recombinant Human CIART Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human CIART Protein, N-GST & C-His
HA556012-03 1 mg

Recombinant Human CIART Protein, N-GST & C-His

Sign In for Pricing
View Details