VTCN1 Peptide - middle region
VTCN1 Peptide - middle region
Product Specifications
Product Name Alternative
B7X, B7H4, B7S1, B7-H4, B7h.5, VCTN1, PRO1291
UniProt
Q7Z7D3
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with VTCN1 Rabbit Polyclonal Antibody (orb589747) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001240778.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-S111390-25MG 25 mg
Sodium (2S,4S)-4-Cyclohexyl-1-(3-oxopentanoyl)pyrrolidine-2-carboxylate
Sign In for Pricing
View Details ![Factor I (CFI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B5]](https://cdn.genprice.uk/products/937/6868c3d7994c49e6dc3ffa54/imageurl/ta806115am.webp)
TA806115AM 100 µL
Factor I (CFI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B5]
Sign In for Pricing
View Details 