Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKRP Peptide - N-terminal region

FKRP Peptide - N-terminal region

Product Specifications

Product Name Alternative

MDC1C, LGMD2I, MDDGA5, MDDGB5, MDDGC5

UniProt

Q9H9S5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FKRP Rabbit Polyclonal Antibody (orb589748) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001034974.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLLVLFYVSWLQHQPRNSRARGPRRASAAGPRVTVLVREFEAFDNAVPEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-500 1x 500 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-100 1x 100 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-500 1x 500 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
BNC941081-100 1x 100 µL

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF680R conjugate, 0.1mg/mL
BNC810322-100 1x 100 µL

CD3e (RIV9), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-100 1x 100 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details