Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRNAA20 3'UTR Lenti-reporter-Luc Vector

Product Specifications

Gene Name

TRNAA20

Vector Name

pLenti-UTR-Luc

Origin

Human

Shipping Conditions

Ambient Temperature

Storage Conditions

1 year when stored at -20°C or lower in a non-frost free freezer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Thyroid gland
CS505524 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Mynn ORF Vector (Mouse) (pORF)
ORF050886 1.0 µg DNA

Mynn ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
HY-P3431 1 Each

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
FOXO1A (Forkhead Box O1, FKH1, FKHR, FOXO1A) (MaxLight 650)
246313-ML650 100 µL

FOXO1A (Forkhead Box O1, FKH1, FKHR, FOXO1A) (MaxLight 650)

Sign In for Pricing
View Details
IgG
GWB-36BAB0 10 mg

IgG

Sign In for Pricing
View Details
ADM2 Rabbit Polyclonal Antibody
E53P10708 100 µL

ADM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details