Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASGRP1 Peptide - middle region

RASGRP1 Peptide - middle region

Product Specifications

Product Name Alternative

V, RASGRP, hRasGRP1, CALDAG-GEFI, CALDAG-GEFII

UniProt

O95267

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASGRP1 Rabbit Polyclonal Antibody (orb589750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001122074.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue, Total Protein, Human Disease, Alzheimer's Disease, Brain, Postcentral Gyrus
MBS657585-01 1 mg

Tissue, Total Protein, Human Disease, Alzheimer's Disease, Brain, Postcentral Gyrus

Sign In for Pricing
View Details
Tissue, Total Protein, Human Disease, Alzheimer's Disease, Brain, Postcentral Gyrus
MBS657585-02 5x 1 mg

Tissue, Total Protein, Human Disease, Alzheimer's Disease, Brain, Postcentral Gyrus

Sign In for Pricing
View Details
Mmu-miR-6963-5p agomir
HY-R03654A-01 5 nmol

Mmu-miR-6963-5p agomir

Sign In for Pricing
View Details
Mmu-miR-6963-5p agomir
HY-R03654A-02 20 nmol

Mmu-miR-6963-5p agomir

Sign In for Pricing
View Details
Cyp11b3 Protein Vector (Rat) (pPM-C-His)
PV262713 500 ng

Cyp11b3 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
IAV inhibitor 4l
orb1741026-01 25 mg

IAV inhibitor 4l

Sign In for Pricing
View Details