Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASGRP1 Peptide - middle region

RASGRP1 Peptide - middle region

Product Specifications

Product Name Alternative

V, RASGRP, hRasGRP1, CALDAG-GEFI, CALDAG-GEFII

UniProt

O95267

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASGRP1 Rabbit Polyclonal Antibody (orb589750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001122074.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Spindlin 3 (SPIN3)
MBS2085219-01 0.1 mL

FITC-Linked Polyclonal Antibody to Spindlin 3 (SPIN3)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Spindlin 3 (SPIN3)
MBS2085219-02 0.2 mL

FITC-Linked Polyclonal Antibody to Spindlin 3 (SPIN3)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Spindlin 3 (SPIN3)
MBS2085219-03 0.5 mL

FITC-Linked Polyclonal Antibody to Spindlin 3 (SPIN3)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Spindlin 3 (SPIN3)
MBS2085219-04 1 mL

FITC-Linked Polyclonal Antibody to Spindlin 3 (SPIN3)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Spindlin 3 (SPIN3)
MBS2085219-05 5 mL

FITC-Linked Polyclonal Antibody to Spindlin 3 (SPIN3)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Spindlin 3 (SPIN3)
MBS2085219-06 5x 5 mL

FITC-Linked Polyclonal Antibody to Spindlin 3 (SPIN3)

Sign In for Pricing
View Details