Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRGAP2 Peptide - N-terminal region

SRGAP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FNBP2, SRGAP3, SRGAP2A, ARHGAP34

UniProt

P0DJJ0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRGAP2 Rabbit Polyclonal Antibody (orb586203) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001258799

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AERFLAKTCSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,6-Dichloro-2,5-Diformamidopyrimidine
TRC-D398480-50MG 50 mg

4,6-Dichloro-2,5-Diformamidopyrimidine

Sign In for Pricing
View Details
Cast Mouse Gene Knockout Kit (CRISPR)
KN502577 1 Kit

Cast Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IL-32 Antibody Pair Set
E-KAB-0233 50 µL & 100 µg

Human IL-32 Antibody Pair Set

Sign In for Pricing
View Details
Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker), CF640R conjugate, 0.1mg/mL
BNC401645-100 1x 100 µL

Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SPON1 Human Gene Knockout Kit (CRISPR)
KN418131 1 Kit

SPON1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS704734 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details