Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRGAP2 Peptide - N-terminal region

SRGAP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FNBP2, SRGAP3, SRGAP2A, ARHGAP34

UniProt

P0DJJ0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRGAP2 Rabbit Polyclonal Antibody (orb586203) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001258799

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AERFLAKTCSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbc1d1 Mouse Gene Knockout Kit (CRISPR)
KN517233 1 Kit

Tbc1d1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD66 (CEA) (COL-1 + CEA31 + C66/261), 1mg/mL
BNUM0747-50 1x 50 µL

CD66 (CEA) (COL-1 + CEA31 + C66/261), 1mg/mL

Sign In for Pricing
View Details
Human PAOX activation kit by CRISPRa
GA116286 1 Kit

Human PAOX activation kit by CRISPRa

Sign In for Pricing
View Details
2X AtTaq Master Mix, 100app
PLMM02 100 Applications

2X AtTaq Master Mix, 100app

Sign In for Pricing
View Details
Vertical Autoclave BAVT-3203
BAVT-3203 1 Unit

Vertical Autoclave BAVT-3203

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgA,  10nm
GM-17-10 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgA, 10nm

Sign In for Pricing
View Details