BMP8A Peptide - middle region
BMP8A Peptide - middle region
Product Specifications
UniProt
Q7Z5Y6
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BMP8A Rabbit Polyclonal Antibody (orb586249) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_861525
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FFRASPSPIRTPRAVRPLRRRQPKKSNELPQANRLPGIFDDVRGSHGRQV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
034507-HRP 200 µL
DCLK2, NT (DCLK2, DCAMKL2, DCDC3B, DCK2, Serine/threonine-protein kinase DCLK2, CaMK-like CREB regulatory kinase 2, Doublecortin domain-containing protein 3B, Doublecortin-like and CAM kinase-like 2, Doublecortin-like kinase 2) (Azide free) (HRP) discontinued
Sign In for Pricing
View Details 
036627 200 µL
HLA-F, ID (HLA-F, HLA-5.4, HLAF, HLA class I histocompatibility antigen, alpha chain F, CDA12, HLA F antigen, Leukocyte antigen F, MHC class I antigen F) discontinued
Sign In for Pricing
View Details