BMP8A Peptide - middle region
BMP8A Peptide - middle region
Product Specifications
UniProt
Q7Z5Y6
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BMP8A Rabbit Polyclonal Antibody (orb586249) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_861525
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FFRASPSPIRTPRAVRPLRRRQPKKSNELPQANRLPGIFDDVRGSHGRQV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRV-0051607-01 20 µL
Polyclonal Antibody to Fibroblast Growth Factor 7 (FGF7)
Sign In for Pricing
View Details TRV-0051607-02 100 µL
Polyclonal Antibody to Fibroblast Growth Factor 7 (FGF7)
Sign In for Pricing
View Details