Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PXDN Peptide - C-terminal region

PXDN Peptide - C-terminal region

Product Specifications

Product Name Alternative

PXN, VPO, MG50, PRG2, COPOA, D2S448, D2S448E

UniProt

Q92626

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PXDN Rabbit Polyclonal Antibody (orb588699) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_036425.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VWQDCCEDCRTRGQFNAFSYHFRGRRSLEFSYQEDKPTKKTRPRKIPSVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhodamine 3B perchlorate
orb2565359-01 50 mg

Rhodamine 3B perchlorate

Sign In for Pricing
View Details
Rhodamine 3B perchlorate
orb2565359-02 10 mg

Rhodamine 3B perchlorate

Sign In for Pricing
View Details
Rabbit Polyclonal CSK Antibody
NBP1-85951-25ul 25 µL

Rabbit Polyclonal CSK Antibody

Sign In for Pricing
View Details
3- (4-Ethylphenyl) -3-oxetanol
OR1084109-01 250 mg

3- (4-Ethylphenyl) -3-oxetanol

Sign In for Pricing
View Details
3- (4-Ethylphenyl) -3-oxetanol
OR1084109-02 500 mg

3- (4-Ethylphenyl) -3-oxetanol

Sign In for Pricing
View Details
3- (4-Ethylphenyl) -3-oxetanol
OR1084109-03 1 g

3- (4-Ethylphenyl) -3-oxetanol

Sign In for Pricing
View Details