Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PXDN Peptide - C-terminal region

PXDN Peptide - C-terminal region

Product Specifications

Product Name Alternative

PXN, VPO, MG50, PRG2, COPOA, D2S448, D2S448E

UniProt

Q92626

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PXDN Rabbit Polyclonal Antibody (orb588699) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_036425.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VWQDCCEDCRTRGQFNAFSYHFRGRRSLEFSYQEDKPTKKTRPRKIPSVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTEN Protein Lysate (Mouse) with C-HA Tag
38072034 100 µg

PTEN Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
AK5 Antibody
ABD8898 100 µg

AK5 Antibody

Sign In for Pricing
View Details
HRP-conjugated Mouse anti MBP-Tag
MBS9144368-01 0.1 mL

HRP-conjugated Mouse anti MBP-Tag

Sign In for Pricing
View Details
HRP-conjugated Mouse anti MBP-Tag
MBS9144368-02 5x 0.1 mL

HRP-conjugated Mouse anti MBP-Tag

Sign In for Pricing
View Details
Hepatocyte Growth Factor Activator Inhibitor 1 (HAI-1, Serine Protease Inhibitor Kunitz-Type I, SPINT1) (Biotin)
H2005-30B 250 µg

Hepatocyte Growth Factor Activator Inhibitor 1 (HAI-1, Serine Protease Inhibitor Kunitz-Type I, SPINT1) (Biotin)

Sign In for Pricing
View Details
Hexokinase 1 + 2 antibody
10R-1073 100 ul

Hexokinase 1 + 2 antibody

Sign In for Pricing
View Details