Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHPN2 Peptide - N-terminal region

RHPN2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RHOBP, P76RBE

UniProt

Q8IUC4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHPN2 Rabbit Polyclonal Antibody (orb589359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_149094.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PAAPQPLEKENDGYFRKGCNPLAQTGRSKLQNQRAALNQQILKAVRMRTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BACE1 (NM_012104) Human Over-expression Lysate
LC402147 20 µg

BACE1 (NM_012104) Human Over-expression Lysate

Sign In for Pricing
View Details
Sulfathiazol-BSA Conjugate
50029-AAT 1 mg

Sulfathiazol-BSA Conjugate

Sign In for Pricing
View Details
Slc25a39 Mouse Gene Knockout Kit (CRISPR)
KN515986 1 Kit

Slc25a39 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin, pan (KRTL/1077 + KRTH/1076), Biotin conjugate, 0.1mg/mL
BNCB1100-100 1x 100 µL

Cytokeratin, pan (KRTL/1077 + KRTH/1076), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KRN7000
TRC-K660000-10MG 10 mg

KRN7000

Sign In for Pricing
View Details
Annexin IV (ANXA4) (N-term) Rabbit Polyclonal Antibody
AP23295PU-N 100 µg

Annexin IV (ANXA4) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details