Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHPN2 Peptide - N-terminal region

RHPN2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RHOBP, P76RBE

UniProt

Q8IUC4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHPN2 Rabbit Polyclonal Antibody (orb589359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_149094.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PAAPQPLEKENDGYFRKGCNPLAQTGRSKLQNQRAALNQQILKAVRMRTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGF2BP1 Human Gene Knockout Kit (CRISPR)
KN416226 1 Kit

IGF2BP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), 0.2mg/mL
BNUB1897-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), 0.2mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (Kap-56), Biotin conjugate, 0.1mg/mL
BNCB0859-500 1x 500 µL

Human Kappa Light Chain (Kap-56), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Daidzin
TRC-D103530-5MG 5 mg

Daidzin

Sign In for Pricing
View Details
AOC2 (NM_001158) Human Over-expression Lysate
LY400465 100 µg

AOC2 (NM_001158) Human Over-expression Lysate

Sign In for Pricing
View Details
RASSF1 (NM_007182) Human Over-expression Lysate
LY402099 100 µg

RASSF1 (NM_007182) Human Over-expression Lysate

Sign In for Pricing
View Details