PAQR3 Peptide - N-terminal region
PAQR3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RKTG
UniProt
Q6TCH7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PAQR3 Rabbit Polyclonal Antibody (orb589399) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001035292.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ELGSYQYWPVLVPRGIRLYTYEQIPGSLKDNPYITDGYRAYLPSRLCIKS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680050-100 1x 100 µL
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682149-100 1x 100 µL
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (rKRT16/1714), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400718-100 1x 100 µL
HER-2 / CD340 (HRB2/718), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 