Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNTNAP2 Peptide - middle region

CNTNAP2 Peptide - middle region

Product Specifications

Product Name Alternative

CDFE, NRXN4, AUTS15, CASPR2, PTHSL1

UniProt

A0A0J9YYA0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNTNAP2 Rabbit Polyclonal Antibody (orb589518) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_054860.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRYNFQAPATNARDSSSRVDNAPDQQNSHPDLAQEEIRFSFSTTKAPCIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3,6-dibromo-2-fluorophenyl) (thiophen-2-yl) methanol
PC1021053-01 250 mg

(3,6-dibromo-2-fluorophenyl) (thiophen-2-yl) methanol

Sign In for Pricing
View Details
(3,6-dibromo-2-fluorophenyl) (thiophen-2-yl) methanol
PC1021053-02 500 mg

(3,6-dibromo-2-fluorophenyl) (thiophen-2-yl) methanol

Sign In for Pricing
View Details
(3,6-dibromo-2-fluorophenyl) (thiophen-2-yl) methanol
PC1021053-03 1 g

(3,6-dibromo-2-fluorophenyl) (thiophen-2-yl) methanol

Sign In for Pricing
View Details
Mouse Anti-UHRF1 Recombinant Antibody (ZG-0495F)
ZG-0495F Each

Mouse Anti-UHRF1 Recombinant Antibody (ZG-0495F)

Sign In for Pricing
View Details
Dpf3 Mouse shRNA Plasmid (Locus ID 70127)
TR515258 1 Kit

Dpf3 Mouse shRNA Plasmid (Locus ID 70127)

Sign In for Pricing
View Details
HSP70 rabbit pAb Antibody
orb767029 100 µL

HSP70 rabbit pAb Antibody

Sign In for Pricing
View Details