POU5F1 Peptide - N-terminal region
POU5F1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
OCT3, OCT4, OTF3, OTF4, OTF-3, Oct-3, Oct-4
UniProt
Q01860
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POU5F1 Rabbit Polyclonal Antibody (orb573785) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001272916
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MHFYRLFLGATRRFLNPEWKGEIDNWCVYVLTSLLPFKIQSQDIKALQKE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
