SMARCB1 Peptide - middle region
SMARCB1 Peptide - middle region
Product Specifications
Product Name Alternative
RDT, CSS3, INI1, SNF5, Snr1, BAF47, MRD15, RTPS1, Sfh1p, hSNFS, SNF5L1, SWNTS1, PPP1R144
UniProt
Q12824
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001007469
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQF
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS636473-01 0.02 mg
Tumor Necrosis Factor Receptor 1, Soluble, Recombinant, Human (sTNFR1)
Sign In for Pricing
View Details 
MBS636473-02 5x 0.02 mg
Tumor Necrosis Factor Receptor 1, Soluble, Recombinant, Human (sTNFR1)
Sign In for Pricing
View Details