Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCB1 Peptide - middle region

SMARCB1 Peptide - middle region

Product Specifications

Product Name Alternative

RDT, CSS3, INI1, SNF5, Snr1, BAF47, MRD15, RTPS1, Sfh1p, hSNFS, SNF5L1, SWNTS1, PPP1R144

UniProt

Q12824

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001007469

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQF

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1.2 Recombinant Rabbit mAb
E43S46242 100 µL

Histone H1.2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Rat Plakophilin 1 ELISA Kit
MBS728379-01 48 Well

Rat Plakophilin 1 ELISA Kit

Sign In for Pricing
View Details
Rat Plakophilin 1 ELISA Kit
MBS728379-02 96 Well

Rat Plakophilin 1 ELISA Kit

Sign In for Pricing
View Details
Rat Plakophilin 1 ELISA Kit
MBS728379-03 5x 96 Well

Rat Plakophilin 1 ELISA Kit

Sign In for Pricing
View Details
Rat Plakophilin 1 ELISA Kit
MBS728379-04 10x 96 Well

Rat Plakophilin 1 ELISA Kit

Sign In for Pricing
View Details
FNTA antibody
70R-17339 50 μL

FNTA antibody

Sign In for Pricing
View Details