Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CREB3L2 Peptide - C-terminal region

CREB3L2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BBF2H7

UniProt

Q70SY1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CREB3L2 Rabbit Polyclonal Antibody (orb575200) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_919047

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGWDRGSSLLRVSGLESRPDVDLPHFIISNETSLEKSVLLELQQHLVSAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIT2 (G Protein-Coupled Receptor Kinase Interacting ArfGAP 2, CAT-2, DKFZp686G01261, KIAA0148, MGC760) (PE)
246606-PE 100 µL

GIT2 (G Protein-Coupled Receptor Kinase Interacting ArfGAP 2, CAT-2, DKFZp686G01261, KIAA0148, MGC760) (PE)

Sign In for Pricing
View Details
Hamster Cluster of Differentiation 24 ELISA Kit
MBS105404-01 48 Well

Hamster Cluster of Differentiation 24 ELISA Kit

Sign In for Pricing
View Details
Hamster Cluster of Differentiation 24 ELISA Kit
MBS105404-02 96 Well

Hamster Cluster of Differentiation 24 ELISA Kit

Sign In for Pricing
View Details
Hamster Cluster of Differentiation 24 ELISA Kit
MBS105404-03 5x 96 Well

Hamster Cluster of Differentiation 24 ELISA Kit

Sign In for Pricing
View Details
Hamster Cluster of Differentiation 24 ELISA Kit
MBS105404-04 10x 96 Well

Hamster Cluster of Differentiation 24 ELISA Kit

Sign In for Pricing
View Details
Anti-PSMD8 Antibody Picoband®, APC Conjugate
A12465-1-APC 100 µg/Vial

Anti-PSMD8 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details