Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CREB3L2 Peptide - C-terminal region

CREB3L2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BBF2H7

UniProt

Q70SY1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CREB3L2 Rabbit Polyclonal Antibody (orb575200) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_919047

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGWDRGSSLLRVSGLESRPDVDLPHFIISNETSLEKSVLLELQQHLVSAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform (PHKA1) ELISA Kit
abx391814 96 Tests

Rat Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform (PHKA1) ELISA Kit

Sign In for Pricing
View Details
TAAR2 Protein Vector (Human) (pPM-C-His)
PV134461 500 ng

TAAR2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
GSTO1 Rabbit mAb
AB101455 100 µL

GSTO1 Rabbit mAb

Sign In for Pricing
View Details
3- (Piperazin-1-yl) propan-1-ol
HY-W015661 1 Each

3- (Piperazin-1-yl) propan-1-ol

Sign In for Pricing
View Details
NF2 Human Over-expression Lysate
orb1374979 20 µg

NF2 Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-MAPK15 Antibody (Monoclonal, 33M11)
M10088 100 µL

Anti-MAPK15 Antibody (Monoclonal, 33M11)

Sign In for Pricing
View Details