Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF7L2 Peptide - N-terminal region

TCF7L2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TCF4, TCF-4

UniProt

Q9NQB0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCF7L2 Rabbit Polyclonal Antibody (orb577222) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005270141

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2X7 Rabbit Polyclonal Antibody
ER1901-99 100 µL

P2X7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS507966 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
P53 Recombinant Rabbit monoclonal Antibody
HA750545 100 µL

P53 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Primpol Mouse Gene Knockout Kit (CRISPR)
KN313866LP 1 Kit

Primpol Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
trans-Diethyl Stilbestrol Acetate
TRC-D445015-25MG 25 mg

trans-Diethyl Stilbestrol Acetate

Sign In for Pricing
View Details
Annexin V, CF®680R Conjugate
#29070 1x 25 µg

Annexin V, CF®680R Conjugate

Sign In for Pricing
View Details