Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKMT1A Peptide - C-terminal region

CKMT1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CKMT1, U-MtCK, mia-CK

UniProt

P12532

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CKMT1A Rabbit Polyclonal Antibody (orb586784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001015001

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cmpk1 Mouse Gene Knockout Kit (CRISPR)
KN503519 1 Kit

Cmpk1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
[1,2,4]Triazolo[1,5-a]pyridin-5-ol
TRC-T139450-10MG 10 mg

[1,2,4]Triazolo[1,5-a]pyridin-5-ol

Sign In for Pricing
View Details
CD68 (KP1), CF555 conjugate, 0.1mg/mL
BNC550512-500 1x 500 µL

CD68 (KP1), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Myosin Light Chain 2 (MYL2) Rabbit Polyclonal Antibody
AP02680PU-N 100 µL

Myosin Light Chain 2 (MYL2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CXCR5 Recombinant Rabbit Monoclonal Antibody [JB11-40]
ET7107-74 100 µL

CXCR5 Recombinant Rabbit Monoclonal Antibody [JB11-40]

Sign In for Pricing
View Details
CD68 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E6]
TA803288AM 100 µL

CD68 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E6]

Sign In for Pricing
View Details