CKMT1A Peptide - C-terminal region
CKMT1A Peptide - C-terminal region
Product Specifications
Product Name Alternative
CKMT1, U-MtCK, mia-CK
UniProt
P12532
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CKMT1A Rabbit Polyclonal Antibody (orb586784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001015001
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
