Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSPC1 Peptide - C-terminal region

PSPC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PSP1

UniProt

Q8WXF1

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSPC1 Rabbit Polyclonal Antibody (orb589055) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001035879

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QMGSPMGSRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem204 (NM_001001183) Mouse Tagged Lenti ORF Clone
MR202658L3 10 µg

Tmem204 (NM_001001183) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CHST6 Protein Lysate (Human) with C-Ha Tag
16148031 100 µg

CHST6 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Lsm10 ORF Vector (Mouse) (pORF)
ORF049495 1.0 µg DNA

Lsm10 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
APPL1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61064R-BF647-TR 20 µL

APPL1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
BRAP Antibody
E30AC2639 100 µL

BRAP Antibody

Sign In for Pricing
View Details
ZNF37A Rabbit Polyclonal Antibody (HRP)
orb2115608 100 µL

ZNF37A Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details