Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FNIP1 Peptide - middle region

FNIP1 Peptide - middle region

Product Specifications

UniProt

Q8TF40

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FNIP1 Rabbit Polyclonal Antibody (orb589307) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001008738.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRSQAVVDQITRHHTKPLKEERGAIDQHQETKQTTKDQSGESDTQNMVSE

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit TIGAR Antibody
orb1526894-01 10 µL

Rabbit TIGAR Antibody

Sign In for Pricing
View Details
Rabbit TIGAR Antibody
orb1526894-02 100 µL

Rabbit TIGAR Antibody

Sign In for Pricing
View Details
Oxct2b Protein Lysate (Mouse) with C-HA Tag
35843034 100 µg

Oxct2b Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Human POSTN/OSF-2 Protein, C-His
orb2967870-01 50 µg

Recombinant Human POSTN/OSF-2 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human POSTN/OSF-2 Protein, C-His
orb2967870-02 100 µg

Recombinant Human POSTN/OSF-2 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human POSTN/OSF-2 Protein, C-His
orb2967870-03 1 mg

Recombinant Human POSTN/OSF-2 Protein, C-His

Sign In for Pricing
View Details