FNIP1 Peptide - middle region
FNIP1 Peptide - middle region
Product Specifications
UniProt
Q8TF40
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FNIP1 Rabbit Polyclonal Antibody (orb589307) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001008738.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LRSQAVVDQITRHHTKPLKEERGAIDQHQETKQTTKDQSGESDTQNMVSE
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP2-52637-0.025mg 0.025 mg
Rabbit Monoclonal His Tag Antibody (3D5)
Sign In for Pricing
View Details IGMNRSWBK2E100ML 100 mL
Innovative Grade US Origin Monkey Rhesus Whole Blood K2 EDTA 100ml
Sign In for Pricing
View Details 
MBS6383720-01 0.1 mL
KLK2 (Kallikrein-2, Glandular Kallikrein-1, hGK-1, Tissue Kallikrein-2) (Biotin)
Sign In for Pricing
View Details