Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB4 Peptide - N-terminal region

MOB4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2C4D, MOB1, MOB3, PHOCN, PREI3, CGI-95, MOBKL3

UniProt

Q9Y3A3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MOB4 Rabbit Polyclonal Antibody (orb589365) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001094289.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Protein FAM26E, FAM26E ELISA Kit
MBS9328132-01 48 Well

Rat Protein FAM26E, FAM26E ELISA Kit

Sign In for Pricing
View Details
Rat Protein FAM26E, FAM26E ELISA Kit
MBS9328132-02 96 Well

Rat Protein FAM26E, FAM26E ELISA Kit

Sign In for Pricing
View Details
Rat Protein FAM26E, FAM26E ELISA Kit
MBS9328132-03 5x 96 Well

Rat Protein FAM26E, FAM26E ELISA Kit

Sign In for Pricing
View Details
Rat Protein FAM26E, FAM26E ELISA Kit
MBS9328132-04 10x 96 Well

Rat Protein FAM26E, FAM26E ELISA Kit

Sign In for Pricing
View Details
TMPRSS12, NT (TMPRSS12, Transmembrane protease serine 12) (MaxLight 405)
MBS6356718-01 0.1 mL

TMPRSS12, NT (TMPRSS12, Transmembrane protease serine 12) (MaxLight 405)

Sign In for Pricing
View Details
TMPRSS12, NT (TMPRSS12, Transmembrane protease serine 12) (MaxLight 405)
MBS6356718-02 5x 0.1 mL

TMPRSS12, NT (TMPRSS12, Transmembrane protease serine 12) (MaxLight 405)

Sign In for Pricing
View Details