TMEM259 Peptide - N-terminal region
TMEM259 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MBRL, ASBABP1, C19orf6, R32184_3, MEMBRALIN
UniProt
Q4ZIN3
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMEM259 Rabbit Polyclonal Antibody (orb55802) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001028198.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EPAAPGPGPNGGGGGPAPARGPRTPNLNPNPLINVRDRLFHALFFKMAVT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RG239093 10 µg
Lamin A (LMNA) (NM_001282626) Human Tagged ORF Clone
Sign In for Pricing
View Details 
BNC740052-100 1x 100 µL
HCG-intact (HCGab/52), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Elab Fluor® 488 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]](https://cdn.genprice.uk/products/763/68dd14ab061270361e7d29a2/imageurl08/an00429l.webp)
AN00429L-01 50 Tests
Elab Fluor® 488 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
Sign In for Pricing
View Details AN00429L-02 100 Tests
Elab Fluor® 488 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
Sign In for Pricing
View Details AN00429L-03 2x 100 Tests
Elab Fluor® 488 Anti-Mouse MHC I (H-2Kd) Antibody[SF1.1.10]
Sign In for Pricing
View Details