Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM259 Peptide - N-terminal region

TMEM259 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MBRL, ASBABP1, C19orf6, R32184_3, MEMBRALIN

UniProt

Q4ZIN3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM259 Rabbit Polyclonal Antibody (orb55802) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001028198.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPAAPGPGPNGGGGGPAPARGPRTPNLNPNPLINVRDRLFHALFFKMAVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IGFBP-5/IGFBP5 Protein (His Tag)
PKSH032598-01 10 µg

Recombinant Human IGFBP-5/IGFBP5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IGFBP-5/IGFBP5 Protein (His Tag)
PKSH032598-02 50 µg

Recombinant Human IGFBP-5/IGFBP5 Protein (His Tag)

Sign In for Pricing
View Details
PDK3 (NM_001142386) Human Over-expression Lysate
LC428060 20 µg

PDK3 (NM_001142386) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Bright™ Violet 510 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991R1 50 Tests

Elab Bright™ Violet 510 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
Purified Anti-Human CSPG4 Antibody[9.2.27]
AN007420P-01 25 µg

Purified Anti-Human CSPG4 Antibody[9.2.27]

Sign In for Pricing
View Details
Purified Anti-Human CSPG4 Antibody[9.2.27]
AN007420P-02 100 µg

Purified Anti-Human CSPG4 Antibody[9.2.27]

Sign In for Pricing
View Details