AMER2 Peptide - middle region
AMER2 Peptide - middle region
Product Specifications
Product Name Alternative
FAM123A
UniProt
Q8N7J2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AMER2 Rabbit Polyclonal Antibody (orb589410) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_689917.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KHPEKEQQEGVPNSDEGYWDSTTPGPEEDSSSSGKKAGIPRDSYSGDALY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
T5596-0401 1Array
Tissue Array, Human, BioAssayTM Colon cancer, metastasis to liver or lymph nodes with normal liver, colon, lymph nodes controls discontinued
Sign In for Pricing
View Details 
MBS9370529-01 48 Well
Mouse Homeobox Protein Hox-D12 (HOXD12) ELISA Kit
Sign In for Pricing
View Details