AMER2 Peptide - middle region
AMER2 Peptide - middle region
Product Specifications
Product Name Alternative
FAM123A
UniProt
Q8N7J2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AMER2 Rabbit Polyclonal Antibody (orb589410) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_689917.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KHPEKEQQEGVPNSDEGYWDSTTPGPEEDSSSSGKKAGIPRDSYSGDALY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1250756-01 0.02 mg (E-Coli)
Recombinant Escherichia coli O17:K52:H18 HTH-type transcriptional regulator iscR (iscR)
Sign In for Pricing
View Details MBS1250756-02 0.1 mg (E-Coli)
Recombinant Escherichia coli O17:K52:H18 HTH-type transcriptional regulator iscR (iscR)
Sign In for Pricing
View Details MBS1250756-03 0.02 mg (Yeast)
Recombinant Escherichia coli O17:K52:H18 HTH-type transcriptional regulator iscR (iscR)
Sign In for Pricing
View Details MBS1250756-04 0.1 mg (Yeast)
Recombinant Escherichia coli O17:K52:H18 HTH-type transcriptional regulator iscR (iscR)
Sign In for Pricing
View Details MBS1250756-05 0.02 mg (Baculovirus)
Recombinant Escherichia coli O17:K52:H18 HTH-type transcriptional regulator iscR (iscR)
Sign In for Pricing
View Details MBS1250756-06 0.02 mg (Mammalian-Cell)
Recombinant Escherichia coli O17:K52:H18 HTH-type transcriptional regulator iscR (iscR)
Sign In for Pricing
View Details