Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDC1 Peptide - N-terminal region

SDC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SDC, CD138, SYND1, syndecan

UniProt

P18827

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SDC1 Rabbit Polyclonal Antibody (orb589415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001006947.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Kallikrein 2 ELISA Kit
MBS053514 Inquire

Donkey Kallikrein 2 ELISA Kit

Sign In for Pricing
View Details
Phospho-GATA1 (Ser310) Antibody
MBS7133253-01 0.1 mL

Phospho-GATA1 (Ser310) Antibody

Sign In for Pricing
View Details
Phospho-GATA1 (Ser310) Antibody
MBS7133253-02 5x 0.1 mL

Phospho-GATA1 (Ser310) Antibody

Sign In for Pricing
View Details
Rabbit anti-Goat IgG-Fc Fragment Antibody HRP Conjugated
MBS3906132-01 1 mg

Rabbit anti-Goat IgG-Fc Fragment Antibody HRP Conjugated

Sign In for Pricing
View Details
Rabbit anti-Goat IgG-Fc Fragment Antibody HRP Conjugated
MBS3906132-02 5x 1 mg

Rabbit anti-Goat IgG-Fc Fragment Antibody HRP Conjugated

Sign In for Pricing
View Details
CAMKK1 (Calcium/Calmodulin-Dependent Protein Kinase Kinase 1, alpha, CAMKKA, DKFZp761M0423, MGC34095) (APC)
244200-APC 100 µL

CAMKK1 (Calcium/Calmodulin-Dependent Protein Kinase Kinase 1, alpha, CAMKKA, DKFZp761M0423, MGC34095) (APC)

Sign In for Pricing
View Details