PLEKHG6 Peptide - middle region
PLEKHG6 Peptide - middle region
Product Specifications
Product Name Alternative
MyoGEF
UniProt
F5H731
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLEKHG6 Rabbit Polyclonal Antibody (orb589416) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001138328.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PPEDRRHWEIGEGGDSGLTIEKSWRELVPGHKEMSQELCHQQEALWELLT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PE/Cyanine7 Anti-Human CD1a Antibody[OKT-6]](https://cdn.genprice.uk/products/763/68dd14b2061270361e7d4340/imageurl/e-ab-f1126h.webp)
E-AB-F1126H-01 20 Tests
PE/Cyanine7 Anti-Human CD1a Antibody[OKT-6]
Sign In for Pricing
View Details E-AB-F1126H-02 100 Tests
PE/Cyanine7 Anti-Human CD1a Antibody[OKT-6]
Sign In for Pricing
View Details E-AB-F1126H-03 2x 100 Tests
PE/Cyanine7 Anti-Human CD1a Antibody[OKT-6]
Sign In for Pricing
View Details 