MESD Peptide - middle region
MESD Peptide - middle region
Product Specifications
Product Name Alternative
BOCA, MESDC2
UniProt
Q14696
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MESD Rabbit Polyclonal Antibody (orb589419) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_055969.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6307898-01 0.1 mL
HOXB7, ID (HOXB7, HOX2C, Homeobox protein Hox-B7, Homeobox protein HHO.C1, Homeobox protein Hox-2C) (MaxLight 550)
Sign In for Pricing
View Details MBS6307898-02 5x 0.1 mL
HOXB7, ID (HOXB7, HOX2C, Homeobox protein Hox-B7, Homeobox protein HHO.C1, Homeobox protein Hox-2C) (MaxLight 550)
Sign In for Pricing
View Details 
VAng-Lsx3543-1mgEcoli 1 mg (E. coli)
Recombinant Helicobacter Pylori rpoA Protein (aa 1-344)
Sign In for Pricing
View Details 