Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MESD Peptide - middle region

MESD Peptide - middle region

Product Specifications

Product Name Alternative

BOCA, MESDC2

UniProt

Q14696

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MESD Rabbit Polyclonal Antibody (orb589419) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055969.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cortisone [HRP]
DAG1073 0.5ml

Cortisone [HRP]

Sign In for Pricing
View Details
(R) -N-Boc-3-bromo-beta-phenylalanine
sc-272278 10 mg

(R) -N-Boc-3-bromo-beta-phenylalanine

Sign In for Pricing
View Details
Recombinant Human IgE/IGHE Protein, N-His
MBS1578707-01 0.1 mg

Recombinant Human IgE/IGHE Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IgE/IGHE Protein, N-His
MBS1578707-02 1 mg

Recombinant Human IgE/IGHE Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IgE/IGHE Protein, N-His
MBS1578707-03 5x 1 mg

Recombinant Human IgE/IGHE Protein, N-His

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) STE7 Polyclonal Antibody
MBS7187917 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) STE7 Polyclonal Antibody

Sign In for Pricing
View Details