WDR48 Peptide - C-terminal region
WDR48 Peptide - C-terminal region
Product Specifications
Product Name Alternative
P80, UAF1, SPG60
UniProt
Q8TAF3
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WDR48 Rabbit Polyclonal Antibody (orb589522) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001290331.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDPNMDLRTVK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1193382-01 0.02 mg (E-Coli)
Recombinant Shewanella baltica Biotin synthase (bioB)
Sign In for Pricing
View Details MBS1193382-02 0.02 mg (Yeast)
Recombinant Shewanella baltica Biotin synthase (bioB)
Sign In for Pricing
View Details MBS1193382-03 0.1 mg (E-Coli)
Recombinant Shewanella baltica Biotin synthase (bioB)
Sign In for Pricing
View Details MBS1193382-04 0.1 mg (Yeast)
Recombinant Shewanella baltica Biotin synthase (bioB)
Sign In for Pricing
View Details MBS1193382-05 0.02 mg (Baculovirus)
Recombinant Shewanella baltica Biotin synthase (bioB)
Sign In for Pricing
View Details MBS1193382-06 0.02 mg (Mammalian-Cell)
Recombinant Shewanella baltica Biotin synthase (bioB)
Sign In for Pricing
View Details