MUS81 Peptide - middle region
MUS81 Peptide - middle region
Product Specifications
Product Name Alternative
SLX3
UniProt
Q96NY9
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MUS81 Rabbit Polyclonal Antibody (orb589652) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_079404.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RLQRHRTSGGDHAPDSPSGENSPAPQGRLAEVQDSSMPVPAQPKAGGSGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2910019-01 20 µg
Recombinant Saccharomyces cerevisiae Uncharacterized mitochondrial carrier YPR011C (YPR011C)
Sign In for Pricing
View Details orb2910019-02 100 µg
Recombinant Saccharomyces cerevisiae Uncharacterized mitochondrial carrier YPR011C (YPR011C)
Sign In for Pricing
View Details AZA0A8M2BG46-carrier-free 100 µg/Vial
Anti-Zebrafish SPI1B Antibody Picoband®
Sign In for Pricing
View Details