MUS81 Peptide - middle region
MUS81 Peptide - middle region
Product Specifications
Product Name Alternative
SLX3
UniProt
Q96NY9
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MUS81 Rabbit Polyclonal Antibody (orb589652) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_079404.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RLQRHRTSGGDHAPDSPSGENSPAPQGRLAEVQDSSMPVPAQPKAGGSGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRV-0051271-01 24 Tests
Low Sample Volume ELISA Kit for Thyroid Stimulating Hormone (TSH)
Sign In for Pricing
View Details TRV-0051271-02 48 Tests
Low Sample Volume ELISA Kit for Thyroid Stimulating Hormone (TSH)
Sign In for Pricing
View Details TRV-0051271-03 96 Tests
Low Sample Volume ELISA Kit for Thyroid Stimulating Hormone (TSH)
Sign In for Pricing
View Details TRV-0051271-04 5x 96 Tests
Low Sample Volume ELISA Kit for Thyroid Stimulating Hormone (TSH)
Sign In for Pricing
View Details TRV-0051271-05 10x 96 Tests
Low Sample Volume ELISA Kit for Thyroid Stimulating Hormone (TSH)
Sign In for Pricing
View Details 
TRV-0060321-01 20 µL
Monoclonal Antibody to Delta Like Protein 1 (dLL1)
Sign In for Pricing
View Details