Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIPK2 Peptide - middle region

RIPK2 Peptide - middle region

Product Specifications

Product Name Alternative

CCK, RICK, RIP2, CARD3, GIG30, CARDIAK

UniProt

O43353

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RIPK2 Rabbit Polyclonal Antibody (orb589665) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003812.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLNIPVNHGPQEESCGSSQLHENSGSPETSRSLPAPQDNDFLSRKAQDCY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Selectin, Platelet (SELP) ELISA Kit
MBS2022802-01 24 Strip Well

Porcine Selectin, Platelet (SELP) ELISA Kit

Sign In for Pricing
View Details
Porcine Selectin, Platelet (SELP) ELISA Kit
MBS2022802-02 48 Well

Porcine Selectin, Platelet (SELP) ELISA Kit

Sign In for Pricing
View Details
Porcine Selectin, Platelet (SELP) ELISA Kit
MBS2022802-03 96 Well

Porcine Selectin, Platelet (SELP) ELISA Kit

Sign In for Pricing
View Details
Porcine Selectin, Platelet (SELP) ELISA Kit
MBS2022802-04 5x 96 Well

Porcine Selectin, Platelet (SELP) ELISA Kit

Sign In for Pricing
View Details
Porcine Selectin, Platelet (SELP) ELISA Kit
MBS2022802-05 10x 96 Well

Porcine Selectin, Platelet (SELP) ELISA Kit

Sign In for Pricing
View Details
Human Nogo Receptor Recombinant Protein
PROTQ9BZR6-50ug 50 µg

Human Nogo Receptor Recombinant Protein

Sign In for Pricing
View Details