Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPP1 Peptide - C-terminal region

TPP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLN2, GIG1, LPIC, SCAR7, TPP-1

UniProt

O14773

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TPP1 Rabbit Polyclonal Antibody (orb589667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000382.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QHGAGLFDVTRGCHESCLDEEVEGQGFCSGPGWDPVTGWGTPNFPALLKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCN5 (NM_003881) Human Recombinant Protein
PROTO76076 20 µg

CCN5 (NM_003881) Human Recombinant Protein

Sign In for Pricing
View Details
Guinea pig Anti-glucoprotein 210 GP210 ELISA Kit
MBS721340-01 48 Well

Guinea pig Anti-glucoprotein 210 GP210 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-glucoprotein 210 GP210 ELISA Kit
MBS721340-02 96 Well

Guinea pig Anti-glucoprotein 210 GP210 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-glucoprotein 210 GP210 ELISA Kit
MBS721340-03 5x 96 Well

Guinea pig Anti-glucoprotein 210 GP210 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-glucoprotein 210 GP210 ELISA Kit
MBS721340-04 10x 96 Well

Guinea pig Anti-glucoprotein 210 GP210 ELISA Kit

Sign In for Pricing
View Details
Human GAL1 (Galectin 1) CLIA Kit
MBS2530942-01 96 Tests

Human GAL1 (Galectin 1) CLIA Kit

Sign In for Pricing
View Details