Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPP1 Peptide - C-terminal region

TPP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLN2, GIG1, LPIC, SCAR7, TPP-1

UniProt

O14773

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TPP1 Rabbit Polyclonal Antibody (orb589667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000382.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QHGAGLFDVTRGCHESCLDEEVEGQGFCSGPGWDPVTGWGTPNFPALLKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Polyclonal Antibody to Interleukin 2 (IL2)
MBS2112969-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Interleukin 2 (IL2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Interleukin 2 (IL2)
MBS2112969-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Interleukin 2 (IL2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Interleukin 2 (IL2)
MBS2112969-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Interleukin 2 (IL2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Interleukin 2 (IL2)
MBS2112969-04 1 mL

Biotin-Linked Polyclonal Antibody to Interleukin 2 (IL2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Interleukin 2 (IL2)
MBS2112969-05 5 mL

Biotin-Linked Polyclonal Antibody to Interleukin 2 (IL2)

Sign In for Pricing
View Details
Cyclin D2 Polyclonal Antibody
RD82320A-01 60μL

Cyclin D2 Polyclonal Antibody

Sign In for Pricing
View Details