Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

F11R Peptide - C-terminal region

F11R Peptide - C-terminal region

Product Specifications

Product Name Alternative

JAM, KAT, JAM1, JAMA, JCAM, CD321, PAM-1

UniProt

Q9Y624

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with F11R Rabbit Polyclonal Antibody (orb589692) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_058642.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVIVAAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIYSQPSAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF640R conjugate, 0.1mg/mL
BNC402746-500 1x 500 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PELP1 (Center) Rabbit Polyclonal Antibody
AP53256PU-N 400 µL

PELP1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Moesin (rMSN/492), CF740 conjugate, 0.1mg/mL
BNC742307-500 1x 500 µL

Moesin (rMSN/492), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Vinylnaphthalene [Stabilized with 4000ppm tert-Butylcatechol]
TRC-V425000-25G 25 g

1-Vinylnaphthalene [Stabilized with 4000ppm tert-Butylcatechol]

Sign In for Pricing
View Details
Retinoid X Receptor beta (RXRB) (NM_021976) Human Over-expression Lysate
LY402896 100 µg

Retinoid X Receptor beta (RXRB) (NM_021976) Human Over-expression Lysate

Sign In for Pricing
View Details
AVPR V2 (AVPR2) Rabbit Polyclonal Antibody
AP01435PU-N 100 µg

AVPR V2 (AVPR2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details