Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

F11R Peptide - C-terminal region

F11R Peptide - C-terminal region

Product Specifications

Product Name Alternative

JAM, KAT, JAM1, JAMA, JCAM, CD321, PAM-1

UniProt

Q9Y624

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with F11R Rabbit Polyclonal Antibody (orb589692) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_058642.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVIVAAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIYSQPSAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroglobulin (Thyroidal Cell Marker) (r2H11), CF568 conjugate, 0.1mg/mL
BNC682161-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (r2H11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GSG1L2 activation kit by CRISPRa
GA118722 1 Kit

Human GSG1L2 activation kit by CRISPRa

Sign In for Pricing
View Details
CD6 (C6/372), Biotin conjugate, 0.1mg/mL
BNCB0372-500 1x 500 µL

CD6 (C6/372), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adipic Acid Monoethyl Ester
TRC-A144890-25G 25 g

Adipic Acid Monoethyl Ester

Sign In for Pricing
View Details
HCFC1 Human Gene Knockout Kit (CRISPR)
KN215341 1 Kit

HCFC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ndufs4 (NM_010887) Mouse Tagged ORF Clone
MG201277 10 µg

Ndufs4 (NM_010887) Mouse Tagged ORF Clone

Sign In for Pricing
View Details