Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAP1 Peptide - C-terminal region

ACAP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CENTB1

UniProt

Q15027

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACAP1 Rabbit Polyclonal Antibody (orb585264) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055531

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLRLAKMREAEAAQGQAGDETYLDIFRDFSLMASDDPEKLSRRSHDLHTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytokeratin 8 Antibody (B22.1) [DyLight 594]
NBP3-11566DL594 0.1 mL

Mouse Monoclonal Cytokeratin 8 Antibody (B22.1) [DyLight 594]

Sign In for Pricing
View Details
OVGP1 Antibody
OAPB00736-100UG 0.1 mg

OVGP1 Antibody

Sign In for Pricing
View Details
MAGEA5 protein (His tag)
80R-2219 50 ug

MAGEA5 protein (His tag)

Sign In for Pricing
View Details
Caspase3 Polyclonal Conjugated Antibody
orb1628679 100 µL

Caspase3 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
CHMP3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV678087 1.0 µg DNA

CHMP3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
PACAP-38 Polyclonal Antibody, Cy5 Conjugated
bs-0200R-Cy5 100 µL

PACAP-38 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details