Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAP1 Peptide - C-terminal region

ACAP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CENTB1

UniProt

Q15027

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACAP1 Rabbit Polyclonal Antibody (orb585264) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055531

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLRLAKMREAEAAQGQAGDETYLDIFRDFSLMASDDPEKLSRRSHDLHTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Homeobox protein HMX2 (HMX2) Mouse ELISA Kit
E0940 96 Tests

Homeobox protein HMX2 (HMX2) Mouse ELISA Kit

Sign In for Pricing
View Details
60S ribosomal protein L18 (RPL18) Mouse ELISA Kit
B1304 96 Tests

60S ribosomal protein L18 (RPL18) Mouse ELISA Kit

Sign In for Pricing
View Details
Rat Epsti1 Pre-designed siRNA Set B
SI204529B 1 Each

Rat Epsti1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human MMP10 protein
orb382998-01 20 µg

Human MMP10 protein

Sign In for Pricing
View Details
Human MMP10 protein
orb382998-02 100 µg

Human MMP10 protein

Sign In for Pricing
View Details
Human MMP10 protein
orb382998-03 1 mg

Human MMP10 protein

Sign In for Pricing
View Details