Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WASL Peptide - N-terminal region

WASL Peptide - N-terminal region

Product Specifications

Product Name Alternative

NWASP, WASPB, N-WASP

UniProt

O00401

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WASL Rabbit Polyclonal Antibody (orb585668) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003932

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Shaking Water Bath BBSW-2702
BBSW-2702 1 Unit

Shaking Water Bath BBSW-2702

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 beta (CCL19) (NM_006274) Human Over-expression Lysate
LC401889 20 µg

Macrophage Inflammatory Protein 3 beta (CCL19) (NM_006274) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Nitroso Vortioxetine
TRC-N620560-50MG 50 mg

N-Nitroso Vortioxetine

Sign In for Pricing
View Details
Mouse Cast activation kit by CRISPRa
GA200546 1 Kit

Mouse Cast activation kit by CRISPRa

Sign In for Pricing
View Details
Rarg Mouse Gene Knockout Kit (CRISPR)
KN514483 1 Kit

Rarg Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human FLRT3 Protein (His Tag)
PKSH033675-01 10 µg

Recombinant Human FLRT3 Protein (His Tag)

Sign In for Pricing
View Details