Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WASL Peptide - N-terminal region

WASL Peptide - N-terminal region

Product Specifications

Product Name Alternative

NWASP, WASPB, N-WASP

UniProt

O00401

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WASL Rabbit Polyclonal Antibody (orb585668) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003932

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab30 Mouse Gene Knockout Kit (CRISPR)
KN514351 1 Kit

Rab30 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GHITM Antibody
8C15977-AAT 50 µg

GHITM Antibody

Sign In for Pricing
View Details
JAB1 (COPS5) Rabbit Polyclonal Antibody
AP20452PU-N 100 µg

JAB1 (COPS5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Trim46 Mouse Gene Knockout Kit (CRISPR)
KN518219 1 Kit

Trim46 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DNA Ligase 1 (1A9), CF488A conjugate, 0.1mg/mL
BNC882177-500 1x 500 µL

DNA Ligase 1 (1A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex II,  15nm
GM-16-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex II, 15nm

Sign In for Pricing
View Details